ARTICLE
Author’s Choice

cro

Identification and quantification of protein S-nitrosation by nitrite in the mouse heart during ischemia
Received for publication, May 30, 2017, and in revised form, July 12, 2017 Published, Papers in Press, July 14, 2017, DOI 10.1074/jbc.M117.798744
Edward T. Chouchani‡§1, Andrew M. James¶2, Carmen Methnerʈ, Victoria R. Pellʈ, Tracy A. Prime¶, Brian K. Erickson‡§, Marleen Forkink¶, Gigi Y. Lau¶, Thomas P. Bright¶, Katja E. Menger¶, Ian M. Fearnley¶, Thomas Kriegʈ, and Michael P. Murphy¶3 From the ‡Department of Cancer Biology, Dana–Farber Cancer Institute, Boston, Massachusetts 02284-9168, the §Department of Cell Biology, Harvard Medical School, Boston, Massachusetts 02115, the ¶Medical Research Council Mitochondrial Biology Unit, University of Cambridge, Cambridge Biomedical Campus, Cambridge CB2 0XY, United Kingdom, and the ʈDepartment of Medicine, University of Cambridge, Addenbrooke’s Hospital, Hills Road, Cambridge CB2 2QQ, United Kingdom
Edited by Ruma Banerjee

Nitrate (NO3؊) and nitrite (NO2؊) are known to be cardioprotective and to alter energy metabolism in vivo. NO3؊ action results from its conversion to NO2؊ by salivary bacteria, but the mechanism(s) by which NO2؊ affects metabolism remains obscure. NO2؊ may act by S-nitrosating protein thiols, thereby altering protein activity. But how this occurs, and the functional
importance of S-nitrosation sites across the mammalian pro-
teome, remain largely uncharacterized. Here we analyzed
protein thiols within mouse hearts in vivo using quantitative
proteomics to determine S-nitrosation site occupancy. We
extended the thiol-redox proteomic technique, isotope-coded affinity tag labeling, to quantify the extent of NO2؊-dependent S-nitrosation of proteins thiols in vivo. Using this approach,
called SNOxICAT (S-nitrosothiol redox isotope-coded affinity tag), we found that exposure to NO2؊ under normoxic conditions or exposure to ischemia alone results in minimal S-nitrosation of protein thiols. However, exposure to NO2؊ in conjunction with ischemia led to extensive S-nitrosation of protein thiols
across all cellular compartments. Several mitochondrial protein
thiols exposed to the mitochondrial matrix were selectively
S-nitrosated under these conditions, potentially contributing to the beneficial effects of NO2؊ on mitochondrial metabolism. The permeability of the mitochondrial inner membrane to HNO2, but not to NO2؊, combined with the lack of S-nitrosation during anoxia alone or by NO2؊ during normoxia places constraints on how S-nitrosation occurs in vivo and on its mechanisms of car-
dioprotection and modulation of energy metabolism. Quantify-
ing S-nitrosated protein thiols now allows determination of
modified cysteines across the proteome and identification of
those most likely responsible for the functional consequences of NO2؊ exposure.
This work was supported by the Medical Research Council UK (MC_ U105663142) and by Wellcome Trust Investigator Award 110159/Z/15/Z (to M. P. M). The authors declare that they have no conflicts of interest with the contents of this article. Author’s Choice—Final version free via Creative Commons CC-BY license.
This article contains supplemental Fig. S1 and Tables S1–S5. 1 To whom correspondence may be addressed. Tel.: 617-632-3281; E-mail:
EdwardT_Chouchani@dfci.harvard.edu. 2 To whom correspondence may be addressed. Tel.: 44-1223-252-903; E-mail:
aj@mrc-mbu.cam.ac.uk. 3 To whom correspondence may be addressed. Tel.: 44-1223-252-900; E-mail:
mpm@mrc-mbu.cam.ac.uk.

Until recently, nitrate (NO3Ϫ) and nitrite (NO2Ϫ) were considered biologically inert byproducts of NO metabolism in mammals, but now it is clear that they impact significantly on mammalian physiology and energy metabolism (1). Dietary NO3Ϫ is converted to NO2Ϫ by salivary bacteria (2), and this NO2Ϫ is thought to account for most of the biological properties of NO3Ϫ in mammals. For example, NO2Ϫ can act in vivo as a cytoprotectant during cardiac ischemia–reperfusion injury (3–5) and as a modulator of mitochondrial function (4) and exercise efficiency (6). How NO2Ϫ exerts its effects in vivo is unclear, but a major component seems to be the S-nitrosation (or S-nitrosylation) of cysteine residues on proteins (7) (Fig. 1A). Protein cysteine S-nitrosation is a posttranslational modification through which NO and its metabolites exert some of their actions by reversibly altering protein function (8 –18). Therefore, a plausible mode of action of NO2Ϫ in vivo is via protein S-nitrosation (Fig. 1A). This notion is supported by a number of studies that have shown that NO2Ϫ treatment in vivo broadly increases protein S-nitrosation (3–5).
Even so, the functional relevance of S-nitrosation by NO2Ϫ in vivo remains uncertain. This is in part because the proteomic methods used to identify the cysteine residues and proteins affected by S-nitrosation (18 –20) do not measure the extent of cysteine modification. Quantification of the extent of protein S-nitrosation on a particular cysteine residue (i.e. site occupancy) is essential to identify the functional nodes through which S-nitrosation may exert its physiological and pharmacological roles. Although many cysteine residues may be modified indiscriminately to a low extent, these alterations are unlikely to have major physiological consequences; instead, we expect that only cysteine residues that are extensively modified by NO2Ϫ can explain the biological actions of this signaling modality (although we cannot exclude gain-of-function effects). To address this unmet need, we adapted cysteinereactive isotope-coded affinity tag (ICAT)4 approaches (21), which both identify and quantify the extent of reversible
4 The abbreviations used are: ICAT, isotope-coded affinity tag; FCCP, carbonyl cyanide p-trifluoromethoxyphenylhydrazone; AAC, ADP/ATP carrier; SNOxICAT, S-nitrosothiol redox isotope-coded affinity tag; OxICAT, redox isotope-coded affinity tag; OXPHOS, oxidative phosphorylation.

14486 J. Biol. Chem. (2017) 292(35) 14486 –14495
© 2017 by The American Society for Biochemistry and Molecular Biology, Inc. Published in the U.S.A.

Measuring cardiac protein S-nitrosation

A

SNO NO+ Pr S -

SPr
S-

-1e-

S Pr

NO

S-

B HS
S S

HS SH
S S
S S

C
SNO
C -ICAT 0
SNO
Cu/Asc, C -ICAT
9
S

in vivo mouse 4 cardiac conditions

S S

S

S

SS SS
LC-MS
9 Da 9 Da

Trypsin
Avidin column

baseline Fig. 2 ischemia Fig. 3

baseline + i.v. sodium
nitrite Fig. 3
ischemia + i.v. sodium
nitrite
Fig. 3

Quantitative SNOxICAT

SNO Pr S -

0% SNO 40% SNO
Figure 1. The SNOxICAT methodology. A, S-nitrosation of sensitive surface protein thiols. A small subset of mitochondrial surface protein thiols are sensitive to S-nitrosation, which is thought to occur by two mechanisms. The thiolate form of a sensitive thiol can react with a nitrosonium ion to form an S-nitrosothiol (left). Alternatively, the thiyl radical form, generated by one electron oxidation of a thiol or thiolate, may react directly with NO⅐ to form an S-nitrosothiol (right). The resulting reversible modification may have functional consequences for the target protein or, alternatively, could block other irreversible oxidative modifications from occurring on the thiol. B, SNOxICAT methodology. Following in vivo interventions, mouse myocardial tissue is excised, and thiols are stabilized by homogenization in 20% TCA containing 0.5% sulfanilamide. Unmodified protein thiols are labeled with C0-ICAT, and then S-nitrosated thiols are chemically reduced and labeled with C9-ICAT, allowing for identification and quantification of the S-nitrosation status of protein thiols across the proteome. The peptides are then isolated and analyzed by mass spectrometry. C, experimental design for comparative analysis of S-nitrosation status in the mouse heart.

modification of a cysteine residue (22–25). To do this, we
modified sample processing so that, instead of identifying all
reversibly modified protein thiols, only S-nitrosated cys-
teines are analyzed and quantified. Application of this
approach, which we term SNOxICAT, allowed us to identify
cysteine residues that are S-nitrosated and, most impor-
tantly, quantify the extent of their S-nitrosation. Here we have used SNOxICAT to study the impact of NO2Ϫ
on the mouse heart in vivo. The heart was chosen because of the
substantial interest in uncovering the mechanisms underlying
both the cytoprotective and other metabolic modulatory effects of NO2Ϫ on cardiac function (1). Using this approach, we have identified a range of protein thiols that were S-nitrosated by NO2Ϫ in the heart and quantified the extent of this modification. Interestingly, the number of protein thiols in the heart substantially modified by NO2Ϫ was dramatically increased by ischemia, suggesting that the combination of NO2Ϫ and ischemia is necessary for extensive S-nitrosation in vivo. S-nitrosation was not increased by NO2Ϫ during normoxia or by ischemia alone. Furthermore, several protein thiols S-nitrosated by NO2Ϫ during ischemia were on mitochondrial proteins, providing a potential mechanistic link to the effects of NO2Ϫ on mitochondrial function.

Results and discussion
Using SNOxICAT to identify and quantify S-nitrosation of cardiac proteins in vivo
In exploring how NO2Ϫ might lead to protein S-nitrosation, and to infer proteins with potential physiological roles, we wanted to identify the sites of S-nitrosation in vivo and also quantify the extent of modification on individual targets. However, S-nitrosothiols are too unstable to survive analysis; hence, they need to be measured indirectly. To do this, we extended the redox-proteomic method OxICAT, which uses Cys-ICAT chemistry to both quantify and identify thiols that are reversibly oxidized, which has been applied to Escherichia coli (22), Saccharomyces cerevisiae (25), Caenorhabditis elegans (23), Drosophila melanogaster (24), and to the mouse heart (26). OxICAT identifies reversibly oxidized protein thiols, so we refined OxICAT to develop the SNOxICAT approach, which reports on S-nitrosated protein thiols (Fig. 1B). To do this, tissue samples were rapidly stabilized by solubilization in TCA in the presence of sulfanilamide (Fig. 1B), which both preserved endogenous S-nitrosothiols and prevented artifactual S-nitrosation of free thiols by acidified NO2Ϫ during sample workup (27) (Fig. 1B). Following stabilization, the samples were neutral-

J. Biol. Chem. (2017) 292(35) 14486 –14495 14487

Measuring cardiac protein S-nitrosation

ized, and unmodified cysteine residues were labeled with “light” C0-ICAT (Fig. 1B), and then protein S-nitrosothiols were labeled with “heavy” C9-ICAT after their selective reduction by Cu(I) was achieved by adding low concentrations of ascorbic acid and CuSO4 (Fig. 1B) (28, 29). Then the sample was digested with trypsin, and cysteine-containing peptides that had reacted with C0-ICAT or C9-ICAT were enriched by affinity purification using the biotin tag on the ICAT reagents, separated by liquid chromatography, and analyzed by MS. As both the C0 and C9 ICAT labeled peptides are chemically identical and elute at the same point after liquid chromatography, this enabled the extent of modification of the cysteine residue of interest to be quantified. In-line sequencing enabled the peptides and their cognate proteins to be identified by MS-MS. Hence, we could identify protein cysteine residues that were S-nitrosated in vivo and, at the same time, determine the extent of this modification.
Quantitative MS-MS data obtained from this approach were applied to several cardiac interventions in vivo (Fig. 1C). Data from individual experiments were cross-referenced using an HPLC-MS alignment algorithm to maximize peptide coverage (30). This enabled both the identification and the quantification of heavy and light ICAT signals for 2203 cysteine residues in the myocardium that came from 721 proteins (supplemental Table S1). These signals were converted to a percent S-nitrosation value ((100 ϫ heavyICAT)/(heavyICAT ϩ lightICAT)) for each particular cysteine residue (supplemental Table S2). From the total pool of identified cysteine peptides with quantitative S-nitrosation data, between 1235 and 1868 were quantified at least three times. One complication with quantifying S-nitrosation is that many cysteines are not S-nitrosated at all; hence, ϳ55% of residues only have one ICAT label. A failure to observe both labels can occur because the residue is either not S-nitrosated or is fully S-nitrosated; alternatively, it may occur for technical reasons related to MS instrumentation and software. Thus, although it is biologically important to include these 0 and 100% S-nitrosated values, a proportion of them are technical artifacts related to a failure in peak identification. To provide an accurate representation of in vivo S-nitrosation required differentiation between these two scenarios. To do this, we noted that a hallmark of informative data points is that they should have similar S-nitrosation across biological replicates and, thus, a low corresponding S.E. Conversely, apparent S-nitrosation values arising because of technical artifacts are unconstrained by the S-nitrosation of their biological replicates and, thus, are likely to exhibit higher S.E. values. Thus, a further curated dataset was generated where peptides with a highly variable cysteine S-nitrosation state were assumed to arise because of technical artifact and were excluded (see supplemental Fig. S1 and “Experimental procedures” for further discussion), leaving 866 –1581 peptides (supplemental Table S3). The total number of cysteine-containing peptides in an in silico trypsin digest of the total mouse genome is ϳ320,000; hence, we observed about ϳ0.5% of the total number of cysteine residues present in the mouse genome.
We first used this approach to explore the baseline levels of S-nitrosation in the normoxic heart (Fig. 2A and supplemental Table S1). Under normoxic conditions, we found 907 cysteine

Frequency (%) Frequency (%)

A 60 50 40 30 20 10 0 0

10

8 6 4

Total S-nitrosation

{

Median = Average =

0.7 7.0

% %

2

0 0 10 20 30 40 50 60 70 80 90 100 S-nitrosation (%)

10 20 30 40 50 60 70 80 90 100 S-nitrosation (%)

B

Distribution of all cysteine residues

Total = 1460

Distribution of C >50% S-nitrosated
cysteine residues Total = 72

Non Mitochondrial

Mitochondrial

Mitochondrial
Non Mitochondrial

Figure 2. Quantification of basal S-nitrosation in the mouse heart by SNOxICAT. A, overall detailed distribution of percentage S-nitrosation status of protein thiols in the heart under baseline conditions. The percentage S-nitrosation status is distributed in 2% quantiles, indicating the proportion of total cysteines identified exhibiting a particular level of S-nitrosation. The inset shows an expansion of these findings. B and C, pie charts showing the relative amount of mitochondrial and non-mitochondrial S-nitrosated cysteine residues in the myocardium under basal conditions for all S-nitrosated proteins detected (B) and for proteins that were S-nitrosated by more than 50% (C).
residues with some degree of sensitivity to copper/ascorbate, consistent with S-nitrosation. This is in agreement with previous studies that have established widespread S-nitrosation under baseline conditions in vivo (19). However, of all the cysteine residues identified, over half were less than 1% S-nitrosated (Fig. 2A), whereas only a small number (ϳ5%, n ϭ 72) were greater than 50% S-nitrosated. Thus, under basal conditions, there is low-level S-nitrosation of several protein thiols, but very few cysteine residues are extensively modified, demonstrating the importance of quantifying site occupancy.
We were particularly interested in assessing the degree of protein S-nitrosation in mitochondria compared with the rest of the cell. Therefore, we divided S-nitrosated proteins into mitochondrial or non-mitochondrial (Fig. 2B) and then further separated proteins that were S-nitrosated by greater than 50% (Fig. 2C). These analyses showed that there was a slight diminishment in enrichment of S-nitrosation in mitochondrial proteins under basal conditions.
Effect of NO2؊ on protein S-nitrosation in the normoxic and ischemic heart
To assess the effect of NO2Ϫ on protein thiols in the heart, we injected NaNO2 intravenously into mice at a concentration that has been reported to protect the heart against ischemia– reperfusion injury and drive S-nitrosation in the heart (4, 31) (Fig. 1C). The S-nitrosation status of cysteine residues in the heart of normoxic mice was largely unchanged by NO2Ϫ injection (Fig. 3A). As the extent of S-nitrosation by NO2Ϫ has been shown to increase upon ischemia (4), we next set out to assess

14488 J. Biol. Chem. (2017) 292(35) 14486 –14495

Measuring cardiac protein S-nitrosation

Frequency (%)

A 70 60 50 40 30 20 10 0 0
B 25
20

Frequency (%)

20 Normoxia Normoxia + nitrite Ischemia
10 Ischemia + nitrite
0 0 20 40 60 80 100
S-nitrosated (%)
10 20 30 40 50 60 70 80 90 100 S-nitrosated (%)
****

Mean S-Nitrosation (%)

15

10 1375

5 1470 0
Control

1581 876
Nitrite Ischemia Nitrite + Ischemia

Figure 3. Effect of NO2؊ on the S-nitrosothiol proteome in the mouse heart under normoxic and ischemic conditions. A, distribution of percent-
age S-nitrosation status of protein thiols in the heart under normoxia, normoxia ϩ NO2Ϫ, ischemia and ischemia ϩ NO2Ϫ. The percentage S-nitrosation status is distributed in 2% quantiles, indicating the proportion of total cys-
teines identified exhibiting a particular level of S-nitrosation. The inset shows
an expansion of these findings. B, the mean percentage S-nitrosation of protein thiols under the four conditions. Data are means Ϯ S.E. The numbers of peptides analyzed are indicated within each column. ****, p Ͻ 0.001 relative to control.

the effects of NO2Ϫ on cardiac S-nitrosation following exposure to 25 min of ischemia (Fig. 3A). Under these conditions, administration of NO2Ϫ led to a dramatic increase in overall S-nitrosation in the ischemic myocardium, although ischemia alone
did not increase S-nitrosation (Fig. 3A). These changes are
quantified in Fig. 3B as the means of the extent of S-nitrosation
of all the peptides. Together, the data in Fig. 3, A and B, suggest
that there was an increase in the average extent of S-nitrosation when there was a combination of NO2Ϫ and ischemia but not with either alone.
To test the effectiveness of the dataset curation and further
assess changes in S-nitrosation, we switched our focus from
aggregate levels of S-nitrosation under different conditions to
the S-nitrosation of individual cysteine residues. As there was
no apparent biological shift in S-nitrosation at the population level in response to NO2Ϫ alone relative to the control, this provided an opportunity to test the validity of our curation
described previously. As expected, the raw and curated plots of
these two independently determined values coalesced around a line of slope ϳ1, with most values clustering near the origin (supplemental Fig. S1, A and C). Furthermore, the shift in Snitrosation with NO2Ϫ and ischemia is readily apparent in both the non-curated and curated datasets (supplemental Fig. S1, B
and D). The data points excluded from analysis show no such
correlation and lacked an excess of statistically interesting com-
parisons above the false discovery rate (supplemental Fig. S1, E
and F). Together, this argues that our curation is appropriate
and effective. Next, we compared how the extent of S-nitrosa-
tion of individual peptides is altered under different conditions.
Volcano plots were created to assess changes in S-nitrosation on individual peptides in response to NO2Ϫ alone, ischemia alone, and ischemia ϩ NO2Ϫ, all relative to control conditions. There was a clear bias toward peptides being significantly S-ni-

trosated by ischemia ϩ NO2Ϫ (Fig. 4A). This was not observed in the symmetrical plots for NO2Ϫ (Fig. 4B) or ischemia alone (Fig. 4C). This is illustrated further in Fig. 4D, which examines the
increase in S-nitrosation on individual peptides. Along the x
axis, we plotted the increase in S-nitrosation on peptides when tissue exposed to NO2Ϫ and ischemia is compared with normoxic tissue exposed to NO2Ϫ. Along the y axis, we plotted the increase in S-nitrosation on peptides when tissue exposed to NO2Ϫ and ischemia is compared with ischemic tissue. The majority of peptides (82%) appear in the top right quadrant with a slope of ϳ1, consistent with S-nitrosation being a process that depends on both ischemia and NO2Ϫ. Of the 1081 cysteines present in both control tissue and that exposed to NO2Ϫ and ischemia, statistical comparisons could be made for 644, and of these, 264 were significantly changed (p Ͻ 0.05). This is an
excess of 232 over the false discovery rate of 32 (supplemental
Fig. S1D). After Benjamini-Hochberg correction for multiple
comparisons, 102 cysteine residues could be identified as changing in response to NO2Ϫ and ischemia (supplemental Table S4). However, although there is a statistically significant
shift in the S-nitrosation status of a large number of peptides with ischemia ϩ NO2Ϫ, many cysteines are not S-nitrosated at all in the control heart and are consequently lost from statistical
comparisons. Consequently, we have focused on large absolute
shifts in S-nitrosation, as these are most likely to contribute to
biologically meaningful changes to protein function within the tissue. Supplemental Table S4 shows the 163 sites where NO2Ϫ in the ischemic myocardium increases S-nitrosation by more than 10 percentage points above conditions of normoxia, NO2Ϫ alone, or ischemia alone.
Thus, we conclude that there is a substantial population of protein cysteines that become selectively S-nitrosated by NO2Ϫ in the ischemic heart but that are unmodified by NO2Ϫ under normoxic conditions or by ischemia alone. This is in agreement
with previous studies that show that overall levels of S-nitrosothiols increase following NO2Ϫ administration under ischemic conditions (32).
S-nitrosation of mitochondrial oxidoreductases by NO2؊ during ischemia
NO2Ϫ has a number of effects on mitochondrial metabolism, and several of the most substantially modified targets of S-ni-
trosation were mitochondrial. To further examine the selective quantitative effects of S-nitrosation by NO2Ϫ in the ischemic heart, we clustered proteins with cysteine thiols exhibiting a differential S-nitrosation status (defined as Ͼ10 percentage
points between conditions) using gene ontology term enrich-
ment, with the total identified population of cysteine thiol con-
taining proteins as the reference background. This approach
identified S-nitrosation targets specific to each intervention
that clustered in specific cellular pathways (Fig. 5A and supple-
mental Table S5). Among the most prevalent targets selectively modified by ischemic NO2Ϫ were mitochondrial oxidoreductases involved in redox metabolism, electron transport, and the
mitochondrial tricarboxylic acid cycle pathways (Fig. 5A and
supplemental Table S5). Interestingly, despite this selective
S-nitrosation of mitochondrial oxidoreductases, the average
extent of S-nitrosation of all mitochondrial peptides (Fig. 5B)

J. Biol. Chem. (2017) 292(35) 14486 –14495 14489

Measuring cardiac protein S-nitrosation

A
Nitrite +Ischemia 8

n = 685

6

- Log p Value

4

2

B n = 450

Nitrite 8
6
4
2

-100 -75 -50 -25 0 25 50 75 100 -100 -75 -50 -25 0 25 50 75 100

Modification Shift

Modification Shift

Y-axis Modification Shift (Nitrite + Ischemia SNOxICAT% -
Ischemia SNOxICAT%)

C

- Log p Value

n = 625

Ischemia 8
6

4

2

X-axis Modification Shift

D

(Nitrite + Ischemia SNOxICAT% Nitrite SNOxICAT%)

100

n = 34

n = 505

75

50

25

-100 -75 -50 -25 -25

25 50 75 100

-100 -75 -50 -25 0 25 50 75 100 Modification Shift

-50
-75 n = 28
-100

n = 48

Figure 4. Relative effect of NO2؊ on the S-nitrosation of individual peptides in the mouse heart under normoxic and ischemic conditions. A–C, volcano plots of the p value for the change in S-nitrosation for individual peptides, comparing the indicated conditions against normoxic control (⌬% points ϭ % S-nitrosation under condition Ϫ % S-nitrosation under normoxia). The n values show the number of peptides for which there was sufficient data under the itgnoodiisniccgahtfeermodmicaoiϩnscdhNiteOiom2Ϫni.aanaldonneortmo oisxcihae. Am, iNaOϩ2ϪNaOnd2Ϫi,sschhoewmniao.nB,tNheO2Ϫy aaxloisn, ep.loCt,tisecdhaegmaiiansatlothnee.sDh,ifctoimn Sp-anriitsroonsaotfiothnefoshr iaftginiviennSp-neiptrtoidseatuiopnofnogr oaignigvefrnopmepNtOid2Ϫeaulpoonne

was similar to that observed for non-mitochondrial peptides
(Fig. 5C). This suggests that mitochondrial oxidoreductases
may be selective targets for modification even when compared
with other mitochondrial proteins. Indeed, many of the pathways identified as enriched targets in the ischemic NO2Ϫ treatments are present in the mitochondrial matrix, as opposed to
mitochondrial protein thiols that face the intermembrane
space or are located on the outer membrane. The mitochon-
drial matrix is a distinct compartment from the rest of the cell, with an environment that may impact NO2Ϫ metabolism during ischemia. To get a clearer picture of whether S-nitrosation was
occurring in the mitochondrial matrix in response to exogenous NO2Ϫ, we limited the analysis to soluble enzymes from the TCA cycle, which are all present in the mitochondrial matrix
(supplemental Table S3). When this was done, there was again
a clear increase in S-nitrosation within the mitochondrial matrix in response to NO2Ϫ and ischemia (Fig. 5D). Thus, the combination of NO2Ϫ and ischemia leads to a clear increase in S-nitrosation within the mitochondrial matrix, although how
this takes place is not known. To explore how the combination of NO2Ϫ and ischemia might
impact the mitochondrial matrix, we examined whether NO2Ϫ itself could gain access to the mitochondrial matrix. When
mitochondria were incubated in a high concentration of KNO3, the organelles did not swell until the Kϩ ionophore valinomycin

was added to enable Kϩ entry along with NO3Ϫ. Valinomycin allows for net uptake of KNO3 and, thereby, leads to swelling, consistent with the mitochondrial inner membrane being permeable to NO3Ϫ (Fig. 5E). In contrast, when mitochondria were incubated in KNO2, addition of valinomycin did not lead to swelling (Fig. 5E), suggesting that the mitochondrial inner membrane is not permeable to NO2Ϫ per se. However, when NO2Ϫ uptake was examined in the presence of valinomycin, along with the uncoupler carbonyl cyanide p-trifluorome-
thoxyphenylhydrazone (FCCP) to render the inner membrane
permeable to protons, it did lead to mitochondrial swelling (Fig. 5E). This indicates that, in vivo, NO2Ϫ itself is unlikely to enter mitochondria but that its conjugate acid HNO2 (pKa ϭ 3.16) can. Therefore, one possibility is that, in vivo during ischemia, NO2Ϫ leads to mitochondrial protein S-nitrosation by generating membrane-permeant HNO2 that can diffuse into the matrix. This membrane permeability may be further enhanced
by the acidic environment likely to be present in ischemic tissue
and could contribute to the increase in S-nitrosation observed with NO2Ϫ and ischemia relative to NO2Ϫ alone. However, the mechanism by which NO2Ϫ leads to S-nitrosation is unclear and may require the further reaction of HNO2 to potential S-nitrosating species such as N2O3 or catalysis by metalloenzymes.
To further explore how ischemic exposure to NO2Ϫ might affect mitochondrial oxidoreductase function, we examined the

14490 J. Biol. Chem. (2017) 292(35) 14486 –14495

Measuring cardiac protein S-nitrosation

A

Condition

Comparator Number of enriched pathways

nitrite + ischemia ischemia nitrite

ischemia nitrite
normoxia nitrite
nitrite + ischemia normoxia ischemia
nitrite + ischemia normoxia

0 0
1 0 0
2

5

9

18

Mean Non-Mitochondrial S-Nitrosation (%)

Mean Mitochondrial S-Nitrosation (%)

B 25 20 15 10

**** ****
****

C 25 20 15 10

**** **** ****
**

55

0 Control

Nitrite Ischemia Nitrite + Ischemia

0 Control

Nitrite Ischemia Nitrite + Ischemia

Mean Matrix S-Nitrosation (%)

D 25 20 15 10 5

**** **** ****

E FCCP Val

Val

FCCP Val

KNO 2

Mitochondrial Swelling

ΔA = 0.5

0

Control Nitrite Ischemia Nitrite + Ischemia

2 min

KNO 3

Figure 5. Intracellular localization of S-nitrosated protein thiols upon NO2؊ and ischemia. A, pathway analysis of proteins containing cysteine residues sensitive to selective S-nitrosation (Ͼ10 percentage point average shift in S-nitrosation) in each treatment protocol, indicating the number of significantly oenf rSi-cnhietrdospaattihown.aEy,sN. BOa2ϪnudpCt,askuebacsesleluslsaerdlobcyalsizwaetilolinngofocfymstietoincehsosnedlericat.ivMeiltyotcahrgoentderdiafo(0r.5S-mnitgropsraottieoinn/bmylN) wO2Ϫeruenindceurbisactheedminic1c0onmdMitiTorniss-.HDC,lT(CpAHc7y.c2l)eatta3rg7e°tCs supplemented with rotenone (4 ␮g/ml) and containing either KNO2 or KNO3 (100 mM). Absorbance was measured at 550 nm, and valinomycin (1 ␮M) or FCCP (2 ␮M) was added where indicated. Shown is a typical result of three replicates. **, p Ͻ 0.01; ****, p Ͻ 0.001.

localization of substantially S-nitrosated sites on these mitochondrial pathways. We focused specifically on mitochondrial oxidoreductase sites that were identified as a cluster that is selectively modified by ischemic NO2Ϫ (supplemental Table S5). Within this cluster, we found 22 sites that mapped to subunits of the OXPHOS machinery (Fig. 6A) and many in regions that have been implicated in regulating oxidative metabolism. For example, complex IV is S-nitrosated on cysteine residues 112 or 115 (Fig. 6B), which co-ordinate Zn2ϩ binding and have been suggested to regulate aspects of complex function (33). Complex III is modified on cysteine residue 139 of subunit IV (Fig. 6C), proximal to the cytochrome c reduction site, whereas both the electron-transferring flavoprotein (Fig. 6D) and succinate dehydrogenase (Fig. 6E) are modified at locations proximal to their flavin oxidation sites. The OXPHOS complex containing the most ischemic S-nitrosation sites (8) was complex I, most notably on four cysteine residues on the NDUFV1 subunit containing the flavin mononucleotide that is the proximal electron acceptor from NADH (Fig. 6, F–H). In addition, there

was substantial S-nitrosation on the ND3 subunit at cysteine 39, which is close to the ubiquinone binding site, and its S-nitrosation is established to inhibit complex I in the ischemic myocardium (16). Substantial S-nitrosation of cysteine residues on NDUFA10 and NDUFA11 was also observed (Fig. 6G). NDUFA11 contributes the contact points between complex I and complex III (34, 35), and the two cysteines may form two disulfides with a further two cysteines on NDUFA11 that were on peptides not observed by SNOxICAT.
In addition to ischemic NO2Ϫ modifications that cluster to functional domains of OXPHOS complexes, it is noteworthy that, under basal conditions, substantial copper/ascorbate-sensitive modification was observed on conserved cysteine residues on two isoforms of the ADP/ATP carrier (AAC1 and AAC2). Both exhibited substantial copper/ascorbate-sensitive modification of cysteine 257 during normoxia (Fig. 6I), despite the two peptides containing cysteine 257 differing in sequence and, consequently, mass. Under basal conditions, this site was among the most substantially modified sites observed (60 –

J. Biol. Chem. (2017) 292(35) 14486 –14495 14491

Measuring cardiac protein S-nitrosation 14492 J. Biol. Chem. (2017) 292(35) 14486 –14495

Measuring cardiac protein S-nitrosation

100% S-nitrosated). The nature of this modification is unclear, as it was largely unmodified under ischemic conditions. This site may be of particular interest, as chemical modification of this cysteine residue has been shown to have substantial effects on AAC protein activity (36). Furthermore, chemical and redox modifications of carrier proteins at this conserved cysteine site have been shown to affect carrier function and mitochondrial metabolism (37–39).
Conclusions
The mechanism by which NO2Ϫ modulates cardiac function in vivo is not clear. To address this, we applied ICAT labeling methods (22, 24) to identify and quantify S-nitrosation occupancy of protein cysteine residues across the proteome. Application of this approach, which we term SNOxICAT, allowed us to identify and quantify the targets of S-nitrosation by NO2Ϫ in the heart in vivo for the first time.
Interestingly, only during ischemia were targets modified in the heart by NO2Ϫ. This suggests that the conditions during ischemia enhance protein S-nitrosation and that oxygen and/or pH are an important constraint on how NO2Ϫ interacts with metabolism. S-nitrosation was not confined to a particular cellular compartment and was distributed throughout the tissue. The NO2Ϫ anion itself is membrane-impermeant and so does not enter mitochondria, suggesting that ischemic NO2Ϫ leads to mitochondrial S-nitrosation because of the membrane permeation of its conjugate acid HNO2. Quantitative assessment of the mitochondrial targets of S-nitrosation revealed a number of interesting candidates for further studies to assess the functional consequences of these modifications and provide an important starting point to further assess how NO2Ϫ exerts its effects on mitochondrial function. In summary, we have developed a new technical approach that provides important new information on how NO2Ϫ and NO2Ϫ may have their beneficial effects in vivo.
Experimental procedures
Mouse experiments
For in vivo heart procedures, an open-chest, in situ heart model was used as described previously (40). Briefly, male C57BL/6 mice (8 –10 weeks old, Charles River Laboratories) were anesthetized with sodium pentobarbital (70 mg/kg intraperitoneally), intubated endotracheally, and ventilated at 110 breaths/min with a tidal volume between 125 and 150 ml. A thoracotomy was performed, and a prominent branch of the left anterior descending coronary artery was surrounded by a 7-0 Prolene suture that was passed through a small plastic tube. Ischemia was induced by tightening the tubing against the heart surface. Mice were divided into four groups: normoxia (sham operation in which the suture was placed but the left anterior

descending coronary artery was not occluded), normoxia ϩ 10 mg/kg systemic intravenous sodium nitrite, 30 min of ischemia, and 30 min of ischemia ϩ 10 mg/kg systemic intravenous sodium nitrite administered at 25 min of ischemia (31).
Cys-ICAT labeling of heart tissue
At all times during S-nitrosothiol derivatization, samples were shielded from light. Following in vivo interventions, heart tissue was rapidly excised and immediately homogenized in ice-cold 20% TCA containing 0.5% sulfanilamide. The homogenate was incubated on ice for 30 min and then pelleted for 30 min at 16,000 ϫ g at 4 °C. The pellet was washed with 10% and 5% (w/v) TCA and then resuspended in 80 ␮l of denaturing alkylating buffer (6 M urea, 2% (w/v) SDS, 200 mM Tris-HCl, 10 mM EDTA, 100 ␮M diethylenetriamine pentaacetate (DTPA), and 10 ␮M neocuproine). The contents of one vial of cysteinereactive cleavable ICAT reagent (AB SCIEX) was added to each biological replicate sample to label reduced cysteine residues at 37 °C and mixed at 1400 rpm for 2 h on an Eppendorf Thermomixer. Sample protein was precipitated with 20% TCA, incubated at 4 °C for 30 min, and pelleted at 4 °C and 16,000 ϫ g for 30 min. The pellet was washed twice as above and then resolubilized in 100 ␮l of denaturing alkylating buffer containing 10 ␮M CuSO4 and 1 mM ascorbic acid to reduce protein S-nitrosothiols in the presence of a second isotopically heavy, cysteinereactive, cleavable ICAT reagent. Proteins were incubated at 37 °C and mixed at 1400 rpm for 2 h. The amount of protein to be processed was optimized to ensure saturation of thiol labeling by the ICAT reagent according to the instructions of the manufacturer. The sample was precipitated with 5 volumes of ice-cold acetone, stored at Ϫ20 °C for 2 h, and pelleted at 4 °C at 16,000 ϫ g for 30 min. The pellet was washed twice with 90% ice-cold acetone and resuspended in denaturing buffer, and then 1 volume of trypsin (AB SCIEX, resuspended in H2O) was added (both provided by the ICAT kit). Proteins were digested at 37 °C with mixing at 1400 rpm overnight. Digested peptides were enriched for cysteine-containing peptides first on a cation exchange cartridge and then on an avidin affinity cartridge (AB SCIEX) as described previously (24). Eluted cysteine-containing, ICAT-labeled peptides were dried down overnight in a SpeedVac, and the biotin moiety of the ICAT label was removed by incubation with the cleaving reagents provided in the ICAT kit for 2 h at 37 °C with mixing at 1400 rpm). The isolated peptides were then dried down in a SpeedVac for MS analysis.
LC/MS-MS analysis of peptides and data analysis
The LC/MS-MS analysis of the SNOxICAT-labeled peptides was carried out using an Orbitrap LTQ XL (Thermo Scientific), where peptides were analyzed after chromatography on a nanoscale reverse-phase column (75-␮m inner diameter, 100-mm

Fwqiuigtahunrsteiufib6cu.aItndioitensncotoiffntihctaaetinSio-innnigtortofasmragtieitotosncohstfoaintsucdhsreoiamflcipycrsSote-tnieniitenrorcesyassitditoeuniensbetyhaNantOda2ϪrpeahstieghlhewcliatgiyvhettaelydrgmienotdsreiofdifeadSn-bndyittNhroeOs2ϪnautdimounrbinecgraouisfsceShd-enmbityrioaissoacnthecedommcyicpstlNeexOinI2؊Ve.(rABe),s,sicdtoruumecstpuglerievxseIInoI (fiCnO),XpePaleHrecOntrtSohneensterzasy.nmBs–feeEsr,, flavoprotein (D, ETF), and succinate dehydrogenase (E, SDH). Structures are also provided for target subunits containing flavin cofactors, indicating the location of the flavin (yellow) and relevant cysteine residues. F, structure of mitochondrial complex I, indicating subunits containing cysteine residues that are selectively modified by NO2Ϫ during ischemia highlighted in red and the number of S-nitrosated cysteine residues given in parentheses. G, quantification of S-nitrosation status of complex I cysteine residues sensitive to modification by ischemic NO2Ϫ. H, structures of the flavin-containing NDUFV1 subunit, indicating the location of the flavin (yellow) and relevant cysteine residues. I, modification of the S-nitrosation status of cysteine residue 257 on AAC1 and AAC2 under different conditions.
J. Biol. Chem. (2017) 292(35) 14486 –14495 14493

Measuring cardiac protein S-nitrosation

length) with a gradient of 0 – 40% buffer B (95% acetonitrile and 0.1% formic acid) in buffer A (5% acetonitrile and 0.1% formic acid) over 84 min at 300 nl/min. Four biological replicates were processed for each experiment. Peptides were identified using Proteome Discoverer (Thermo Scientific) and the Mascot protein identification program (Matrix Science). All experiments used the Mouse UniProt database (2013_12). Searches were performed using a 5-ppm precursor ion tolerance, requiring the N/C terminus of each peptide to have trypsin protease specificity and allowing up to two missed cleavages. ICAT tags on cysteine residues (ϩ227.13 and ϩ236.16 Da) and methionine oxidation (ϩ15.99 Da) were set as variable modifications. Because many peptides were not observed in all replicates, the raw files were then analyzed using MassChroQ software, which quantifies peaks lacking MS2 sequence information by aligning them using the retention time of peptides common to runs for which MS2 information was obtained (30). An in silico tryptic digest of the complete mouse proteome was performed using a modified proteogest script generating a file that listed all cysteinecontaining tryptic peptides with none, one, or two missed cleavages, the cysteine residue number, and the Uniprot accession number of the protein (41). The proteogest script modification was done by Dr. Alan Robinson (Medical Research Council Mitochondrial Biology Unit). The peptide list generated by proteogest was used together with the output from MassChroQ to sum the intensity from all peptide peak signals containing the cysteine residue of interest (i.e. miss-cleaved, methionine oxidation, different z values) and give a combined signal for both the heavy and light forms of the peptide. A significant complication with quantifying S-nitrosation compared with general oxidation is that many cysteines are not S-nitrosated at all, and consequently, in this study under control conditions, ϳ55% of residues in a particular replicate have only one ICAT label. A failure to observe both labels can also occur for technical reasons related to MS instrumentation and software, or it can arise because the residue is either not S-nitrosated at all or it is completely S-nitrosated. The simplest mechanism for resolving this is to discard all peptides that lack both peaks, but excluding 55% of the dataset would give a misleading picture of in vivo S-nitrosation. Conversely, treating a failure of the instrumentation and software to find the correct peak as a biological result is also misleading.
To differentiate between these two situations and provide a more accurate representation of in vivo S-nitrosation, we utilized the expected similarity of informative data points across the four biological replicates. All data points with an S.E. of less than 6 were considered informative and automatically included in the subsequent analyses, comprising 78% of the total. For data points with an S.E. Ն 6, heavy and light ICAT signals were separately cross-referenced to the median heavy or light intensity of that cysteine in the four biological replicates. Those with an intensity signal Յ20% of the heavy or light median intensity were excluded. This step prevents a single technical failure with either a heavy or light peak in one replicate, causing a group of four replicates to be eliminated from analysis. This was necessary, as only 387 cysteine residues (ϳ20%) were sufficiently S-nitrosated to be observed with both heavy and light isotope labels. Finally, all data points that still had an S.E. Ն 8 or n Ͻ 3

were excluded. S-nitrosation is presented as the percentage (100 ϫ HeavyICAT) / (HeavyICAT ϩ LightICAT).
Information on the subcellular localization of the proteins identified and the biological processes they participated in was obtained using MitoMiner (http://mitominer.mrc-mbu.cam. ac.uk/)5 (42). For bar charts, the data for distribution of proportion of cysteine residues against percentage S-nitrosation were generated by counting the number of cysteine residues in each 2% quantile for each individual biological replicate and then averaging the relative values for each quantile over the four biological replicates. For volcano plots of the extent of S-nitrosation of a given cysteine under one condition against its S-nitrosation under another condition, the significance of the shift in S-nitrosation was assessed by an F test for variance followed by the appropriate two-tailed Student’s t test, assuming equal or unequal variance as appropriate. A Benjamini-Hochberg procedure was used to correct for multiple comparisons and thus determine significant changes.
Mitochondrial experiments
Liver mitochondria were prepared from female Wistar rats killed by stunning and cervical dislocation, followed by homogenization of the liver and differential centrifugation in ice-cold STE buffer (250 mM sucrose, 10 mM Tris, and 1 mM EGTA (pH 7.4)). The protein concentration was determined by the biuret assay using bovine serum albumin as a standard. For swelling experiments, mitochondria (0.5 mg protein/ml) were incubated in 10 mM TrisHCl (pH 7.2) at 37 °C supplemented with rotenone (4 ␮g/ml) and containing either KNO2 or KNO3 (100 mM). Absorbance was measured at 550 nm, and valinomycin (1 ␮M) or FCCP (2 ␮M) was added where indicated. Fig. 5E shows a typical result of three replicates.
Author contributions—C. M. and V. R. P. carried out the mouse experiments, supervised by T. K. K. E. M., E. T. C., and I. M. F. established the ICAT protocol and carried out the mass spectrometry. E. T. C. and A. M. J. carried out the data analysis. B. K. E. performed the bioinformatics analyses. T. A. P., T. P. B., M. F., and G. Y. L. carried out experiments on isolated mitochondria. E. T. C., A. M. J., T. K., and M. P. M. directed the project and wrote the manuscript.
Acknowledgments—We thank Michael Harbour for assistance with mass spectrometry and implementing the MassChroQ software and Alan Robinson for providing the modified proteogest script.
References
1. Lundberg, J. O., Weitzberg, E., and Gladwin, M. T. (2008) The nitratenitrite-nitric oxide pathway in physiology and therapeutics. Nat. Rev. Drug Discov. 7, 156 –167
2. Duncan, C., Dougall, H., Johnston, P., Green, S., Brogan, R., Leifert, C., Smith, L., Golden, M., and Benjamin, N. (1995) Chemical generation of nitric oxide in the mouth from the enterosalivary circulation of dietary nitrate. Nat. Med. 1, 546 –551
3. Webb, A., Bond, R., McLean, P., Uppal, R., Benjamin, N., and Ahluwalia, A. (2004) Reduction of nitrite to nitric oxide during ischemia protects against myocardial ischemia-reperfusion damage. Proc. Natl. Acad. Sci. U.S.A. 101, 13683–13688
5 Please note that the JBC is not responsible for the long-term archiving and maintenance of this site or any other third party– hosted site.

14494 J. Biol. Chem. (2017) 292(35) 14486 –14495

Measuring cardiac protein S-nitrosation

4. Shiva, S., Sack, M. N., Greer, J. J., Duranski, M., Ringwood, L. A., Burwell, L., Wang, X., MacArthur, P. H., Shoja, A., Raghavachari, N., Calvert, J. W., Brookes, P. S., Lefer, D. J., and Gladwin, M. T. (2007) Nitrite augments tolerance to ischemia/reperfusion injury via the modulation of mitochondrial electron transfer. J. Exp. Med. 204, 2089 –2102
5. Bryan, N. S., Calvert, J. W., Elrod, J. W., Gundewar, S., Ji, S. Y., and Lefer, D. J. (2007) Dietary nitrite supplementation protects against myocardial ischemia-reperfusion injury. Proc. Natl. Acad. Sci. U.S.A. 104, 19144 –19149
6. Larsen, F. J., Schiffer, T. A., Borniquel, S., Sahlin, K., Ekblom, B., Lundberg, J. O., and Weitzberg, E. (2011) Dietary inorganic nitrate improves mitochondrial efficiency in humans. Cell Metab. 13, 149 –159
7. Haldar, S. M., and Stamler, J. S. (2013) S-nitrosylation: integrator of cardiovascular performance and oxygen delivery. J. Clin. Invest. 123, 101–110
8. Stamler, J. S., Lamas, S., and Fang, F. C. (2001) Nitrosylation: the prototypic redox-based signaling mechanism. Cell 106, 675– 683
9. Jaffrey, S. R., Erdjument-Bromage, H., Ferris, C. D., Tempst, P., and Snyder, S. H. (2001) Protein S-nitrosylation: a physiological signal for neuronal nitric oxide. Nat. Cell Biol. 3, 193–197
10. Murphy, E., Kohr, M., Menazza, S., Nguyen, T., Evangelista, A., Sun, J., and Steenbergen, C. (2014) Signaling by S-nitrosylation in the heart. J. Mol. Cell. Cardiol. 73, 18 –25
11. Hess, D. T., Matsumoto, A., Kim, S. O., Marshall, H. E., and Stamler, J. S. (2005) Protein S-nitrosylation: purview and parameters. Nat. Rev. Mol. Cell Biol. 6, 150 –166
12. Benhar, M., Forrester, M. T., Hess, D. T., and Stamler, J. S. (2008) Regulated protein denitrosylation by cytosolic and mitochondrial thioredoxins. Science 320, 1050 –1054
13. Matsushita, K., Morrell, C. N., Cambien, B., Yang, S. X., Yamakuchi, M., Bao, C., Hara, M. R., Quick, R. A., Cao, W., O’Rourke, B., Lowenstein, J. M., Pevsner, J., Wagner, D. D., and Lowenstein, C. J. (2003) Nitric oxide regulates exocytosis by S-nitrosylation of N-ethylmaleimide-sensitive factor. Cell 115, 139 –150
14. Mitchell, D. A., and Marletta, M. A. (2005) Thioredoxin catalyzes the S-nitrosation of the caspase-3 active site cysteine. Nat. Chem. Biol. 1, 154 –158
15. Sun, J., Morgan, M., Shen, R. F., Steenbergen, C., and Murphy, E. (2007) Preconditioning results in S-nitrosylation of proteins involved in regulation of mitochondrial energetics and calcium transport. Circ. Res. 101, 1155–1163
16. Chouchani, E. T., Methner, C., Nadtochiy, S. M., Logan, A., Pell, V. R., Ding, S., James, A. M., Cochemé, H. M., Reinhold, J., Lilley, K. S., Partridge, L., Fearnley, I. M., Robinson, A. J., Hartley, R. C., Smith, R. A., et al. (2013) Cardioprotection by S-nitrosation of a cysteine switch on mitochondrial complex I. Nat. Med. 19, 753–759
17. Chouchani, E. T., Hurd, T. R., Nadtochiy, S. M., Brookes, P. S., Fearnley, I. M., Lilley, K. S., Smith, R. A., and Murphy, M. P. (2010) Identification of S-nitrosated mitochondrial proteins by S-nitrosothiol difference in gel electrophoresis (SNO-DIGE): implications for the regulation of mitochondrial function by reversible S-nitrosation. Biochem. J. 430, 49 –59
18. Kohr, M. J., Evangelista, A. M., Ferlito, M., Steenbergen, C., and Murphy, E. (2014) S-nitrosylation of TRIM72 at cysteine 144 is critical for protection against oxidation-induced protein degradation and cell death. J. Mol. Cell. Cardiol. 69, 67–74
19. Doulias, P. T., Tenopoulou, M., Greene, J. L., Raju, K., and Ischiropoulos, H. (2013) Nitric oxide regulates mitochondrial fatty acid metabolism through reversible protein S-nitrosylation. Sci. Signal. 6, rs1
20. Seth, D., and Stamler, J. S. (2011) The SNO-proteome: causation and classifications. Curr. Opin. Chem. Biol. 15, 129 –136
21. Gygi, S. P., Rist, B., Gerber, S. A., Turecek, F., Gelb, M. H., and Aebersold, R. (1999) Quantitative analysis of complex protein mixtures using isotopecoded affinity tags. Nat. Biotechnol. 17, 994 –999
22. Leichert, L. I., Gehrke, F., Gudiseva, H. V., Blackwell, T., Ilbert, M., Walker, A. K., Strahler, J. R., Andrews, P. C., and Jakob, U. (2008) Quantifying changes in the thiol redox proteome upon oxidative stress in vivo. Proc. Natl. Acad. Sci. U.S.A. 105, 8197– 8202

23. Knoefler, D., Thamsen, M., Koniczek, M., Niemuth, N. J., Diederich, A. K., and Jakob, U. (2012) Quantitative in vivo redox sensors uncover oxidative stress as an early event in life. Mol. Cell 47, 767–776
24. Menger, K. E., James, A. M., Cochemé, H. M., Harbour, M. E., Chouchani, E. T., Ding, S., Fearnley, I. M., Partridge, L., and Murphy, M. P. (2015) Fasting, but not aging, dramatically alters the redox status of cysteine residues on proteins in Drosophila melanogaster. Cell Rep. 11, 1856 –1865
25. Brandes, N., Tienson, H., Lindemann, A., Vitvitsky, V., Reichmann, D., Banerjee, R., and Jakob, U. (2013) Time line of redox events in aging postmitotic cells. eLife 2, e00306
26. Kumar, V., Kleffmann, T., Hampton, M. B., Cannell, M. B., and Winterbourn, C. C. (2013) Redox proteomics of thiol proteins in mouse heart during ischemia/reperfusion using ICAT reagents and mass spectrometry. Free Rad. Biol. Med. 58, 109 –117
27. Wang, X., Bryan, N. S., MacArthur, P. H., Rodriguez, J., Gladwin, M. T., and Feelisch, M. (2006) Measurement of nitric oxide levels in the red cell: validation of tri-iodide-based chemiluminescence with acid-sulfanilamide pretreatment. J. Biol. Chem. 281, 26994 –27002
28. Wang, X., Kettenhofen, N. J., Shiva, S., Hogg, N., and Gladwin, M. T. (2008) Copper dependence of the biotin switch assay: modified assay for measuring cellular and blood nitrosated proteins. Free Rad. Biol. Med. 44, 1362–1372
29. Chouchani, E. T., James, A. M., Fearnley, I. M., Lilley, K. S., and Murphy, M. P. (2011) Proteomic approaches to the characterization of protein thiol modification. Curr. Opin. Chem. Biol. 15, 120 –128
30. Valot, B., Langella, O., Nano, E., and Zivy, M. (2011) MassChroQ: a versatile tool for mass spectrometry quantification. Proteomics 11, 3572–3577
31. Bryan, N. S., Fernandez, B. O., Bauer, S. M., Garcia-Saura, M. F., Milsom, A. B., Rassaf, T., Maloney, R. E., Bharti, A., Rodriguez, J., and Feelisch, M. (2005) Nitrite is a signaling molecule and regulator of gene expression in mammalian tissues. Nat. Chem. Biol. 1, 290 –297
32. Feelisch, M., Fernandez, B. O., Bryan, N. S., Garcia-Saura, M. F., Bauer, S., Whitlock, D. R., Ford, P. C., Janero, D. R., Rodriguez, J., and Ashrafian, H. (2008) Tissue processing of nitrite in hypoxia: an intricate interplay of nitric oxide-generating and -scavenging systems. J. Biol. Chem. 283, 33927–33934
33. Aagaard, A., and Brzezinski, P. (2001) Zinc ions inhibit oxidation of cytochrome c oxidase by oxygen. FEBS Lett. 494, 157–160
34. Gu, J., Wu, M., Guo, R., Yan, K., Lei, J., Gao, N., and Yang, M. (2016) The architecture of the mammalian respirasome. Nature 537, 639 – 643
35. Wu, M., Gu, J., Guo, R., Huang, Y., and Yang, M. (2016) Structure of mammalian respiratory supercomplex I1III2IV1. Cell 167, 1598–1609.e10
36. Bamber, L., Harding, M., Monné, M., Slotboom, D. J., and Kunji, E. R. (2007) The yeast mitochondrial ADP/ATP carrier functions as a monomer in mitochondrial membranes. Proc. Natl. Acad. Sci. U.S.A. 104, 10830 –10834
37. McStay, G. P., Clarke, S. J., and Halestrap, A. P. (2002) Role of critical thiol groups on the matrix surface of the adenine nucleotide translocase in the mechanism of the mitochondrial permeability transition pore. Biochem. J. 367, 541–548
38. Mailloux, R. J., Seifert, E. L., Bouillaud, F., Aguer, C., Collins, S., and Harper, M. E. (2011) Glutathionylation acts as a control switch for uncoupling proteins UCP2 and UCP3. J. Biol. Chem. 286, 21865–21875
39. Chouchani, E. T., Kazak, L., Jedrychowski, M. P., Lu, G. Z., Erickson, B. K., Szpyt, J., Pierce, K. A., Laznik-Bogoslavski, D., Vetrivelan, R., Clish, C. B., Robinson, A. J., Gygi, S. P., and Spiegelman, B. M. (2016) Mitochondrial ROS regulate thermogenic energy expenditure and sulfenylation of UCP1. Nature 532, 112–116
40. Methner, C., Chouchani, E. T., Buonincontri, G., Pell, V. R., Sawiak, S. J., Murphy, M. P., and Krieg, T. (2014) Mitochondria selective S-nitrosation by mitochondria-targeted S-nitrosothiol protects against post-infarct heart failure in mouse hearts. Eur. J. Heart Fail. 16, 712–717
41. Cagney, G., Amiri, S., Premawaradena, T., Lindo, M., and Emili, A. (2003) In silico proteome analysis to facilitate proteomics experiments using mass spectrometry. Proteome Sci. 1, 5
42. Smith, A. C., and Robinson, A. J. (2009) MitoMiner, an integrated database for the storage and analysis of mitochondrial proteomics data. Mol. Cell. Proteomics 8, 1324 –1337

J. Biol. Chem. (2017) 292(35) 14486 –14495 14495